IL-38 expresses in the fetal skin, spleen and tonsil, mostly in the basal epithelia of skin and in proliferating B cells of the tonsil. IL-38 can bind soluble IL-1 receptor type 1 and may be involved in the regulation of adapted and innate immune responses.
SequenceMCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICTLPNRGLDRTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGE EATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW with polyhistidine tag at the C-terminusSourceEscherichia coliEndotoxin Test<0.1 EU per 1 μg of the protein by the LAL method.Purity>98% as determined by SDS-PAGE.FormLyophilizedStorage BufferLyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.ReconstitutionIt is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.Stability & StorageThis product is stable after storage at: • -20°C for 12 months in lyophilized state from date of receipt. • -20°C or -80°C for 1 month under sterile conditions after reconstitution. Avoid repeated freeze/thaw cycles.
