Interleukin-17A is a protein that in humans is encoded by the IL17A gene. The protein encoded by this gene is a proinflammatory cytokine produced by activated T cells.
This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases.
This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO).
SequenceMIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDY HMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA with polyhistidine tag at the C-terminusUnitProt IDQ16552SourceEscherichia coliEndotoxin Test<0.01 EU per 1 μg of the protein by the LAL method.ActivityMeasure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <6 ng/mL.Purity>98% as determined by SDS-PAGE.FormLyophilizedStorage BufferLyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.ReconstitutionIt is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.Stability & StorageThis product is stable after storage at: • -20°C for 12 months in lyophilized state from date of receipt. • -20°C or -80°C for 1 month under sterile conditions after reconstitution. Avoid repeated freeze/thaw cycles.
Croyez Bioscience Co., Ltd.
